PDB entry 5z5n

View 5z5n on RCSB PDB site
Description: Crystal structure of ConA-R1M
Class: sugar binding protein
Keywords: ConA-R1M, SUGAR BINDING PROTEIN
Deposited on 2018-01-18, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5na_
  • Chain 'B':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5nb_
  • Chain 'C':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5nc_
  • Chain 'D':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5nd_
  • Heterogens: CA, MN, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z5nA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5nA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnal
    hfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwessa
    vvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z5nB (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5nB (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnal
    hfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwessa
    vvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z5nC (C:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5nC (C:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksetn
    alhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwes
    savvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5z5nD (D:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5nD (D:)
    tivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrls
    avvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnalhf
    mfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwessavv
    asfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan