PDB entry 5z5l

View 5z5l on RCSB PDB site
Description: Crystal structure of ConA-R5M
Class: sugar binding protein
Keywords: ConA, R5M, SUGAR BINDING PROTEIN
Deposited on 2018-01-18, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5la_
  • Chain 'B':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5lb_
  • Chain 'C':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5lc_
  • Chain 'D':
    Compound: Concanavalin-A
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5ld_
  • Heterogens: MN, CA, 96O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z5lA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5lA (A:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksetn
    alhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwes
    savvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z5lB (B:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5lB (B:)
    adtivaveltypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrl
    savvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklketnal
    hfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwesas
    featftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z5lC (C:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5lC (C:)
    adtivaveldtypntdigpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkrl
    savvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnalh
    fmfnqfskdqkdlilqgdatttdgnleltrvssngspqgssvgralfyapvhiwessavv
    asfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5z5lD (D:)
    adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
    lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5lD (D:)
    adtivaveldtypntdigdpsypigidiksvrskktakwnmqngkvgtahiiynsvdkrl
    savvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklktnalh
    fmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwessav
    vasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan