PDB entry 5z5f

View 5z5f on RCSB PDB site
Description: Crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from Geobacillus thermoleovorans IT-08 in complex with L-arabinose
Class: hydrolase
Keywords: Xylanolytic, GH43, oligosaccharide, saccharification, HYDROLASE
Deposited on 2018-01-18, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Species: Geobacillus thermoleovorans [TaxId:33941]
    Gene: xyl
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z5fa1, d5z5fa2
  • Heterogens: CA, FUB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z5fA (A:)
    meysnpvikgfypdpsicrvgsdyylvtssfqyfpgvpifhstnlinwnkigyclirpsq
    lmlnnatnrsgifaptlryhegifylittnvtlkknfivmsedlqgewsepiwidgwggi
    dpslffdndgkvyitgtndnargeelgiyqaeidlkkgsiigerkliwkgtggsypeaph
    lykvngwyylliaeggteyghmvtvarskypfgpfescpfnpilthrstnhplqaighad
    ivqyhdgswwavfhgtrpisyppkhhlgretclapikwtddgwpiigyngridikmdagy
    lpvkeknigdeiieddfnsdifstdwnfiqnprlehyslkgrpswlkmrgtektlndins
    ptfigrrqehfvcnvstllefkpnqdneeagltvymnekhhyeialtkkngrinvvlkkt
    vgdiqvvvnsleyfsntiifsiqanpeeykfsfvdpntgqtyllgtglttllstevaggf
    tgvyfglyatgngkvctapaffdwfkyipeikgelnsklegkpipnpllgldstrtghhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5fA (A:)
    meysnpvikgfypdpsicrvgsdyylvtssfqyfpgvpifhstnlinwnkigyclirpsq
    lmlnnatnrsgifaptlryhegifylittnvtlkknfivmsedlqgewsepiwidgwggi
    dpslffdndgkvyitgtndnargeelgiyqaeidlkkgsiigerkliwkgtggsypeaph
    lykvngwyylliaeggteyghmvtvarskypfgpfescpfnpilthrstnhplqaighad
    ivqyhdgswwavfhgtrpisyppkhhlgretclapikwtddgwpiigyngridikmdagy
    lpvkeiieddfnsdifstdwnfiqnprlehyslkgrpswlkmrgtektlndinsptfigr
    rqehfvcnvstllefkpnqdneeagltvymnekhhyeialtkkngrinvvlkktvgdiqv
    vvnsleyfsntiifsiqanpeeykfsfvdpntgqtyllgtglttllstevaggftgvyfg
    lyatgngkvctapaffdwfkyipe