PDB entry 5z5b

View 5z5b on RCSB PDB site
Description: Crystal structure of Tk-PTP in the G95A mutant form
Class: hydrolase
Keywords: tyrosine phosphatase, HYDROLASE
Deposited on 2018-01-17, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase
    Species: Thermococcus kodakarensis KOD1 [TaxId:69014]
    Gene: Tk-ptp, TK0241
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X270 (0-146)
      • engineered mutation (94)
      • expression tag (147-155)
    Domains in SCOPe 2.07: d5z5ba1, d5z5ba2
  • Chain 'B':
    Compound: protein-tyrosine phosphatase
    Species: Thermococcus kodakarensis KOD1 [TaxId:69014]
    Gene: Tk-ptp, TK0241
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X270 (0-146)
      • engineered mutation (94)
      • expression tag (147-155)
    Domains in SCOPe 2.07: d5z5bb1, d5z5bb2
  • Chain 'C':
    Compound: protein-tyrosine phosphatase
    Species: Thermococcus kodakarensis KOD1 [TaxId:69014]
    Gene: Tk-ptp, TK0241
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X270 (0-146)
      • engineered mutation (94)
      • expression tag (147-149)
    Domains in SCOPe 2.07: d5z5bc1, d5z5bc2
  • Heterogens: CL, FMT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z5bA (A:)
    mwpsakfidgrvafsrmpaereldevardfdavvvlvedyelpysldewekrgvevlhgp
    ipdftapsveqlleilrwieervregkkvlihcmaglgrsgtvgvawlmysrglslreal
    mevrrkrpgavetqeqmevlkeleeriklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5bA (A:)
    mwpsakfidgrvafsrmpaereldevardfdavvvlvedyelpysldewekrgvevlhgp
    ipdftapsveqlleilrwieervregkkvlihcmaglgrsgtvgvawlmysrglslreal
    mevrrkrpgavetqeqmevlkeleeriklaaalehh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z5bB (B:)
    mwpsakfidgrvafsrmpaereldevardfdavvvlvedyelpysldewekrgvevlhgp
    ipdftapsveqlleilrwieervregkkvlihcmaglgrsgtvgvawlmysrglslreal
    mevrrkrpgavetqeqmevlkeleeriklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5bB (B:)
    mwpsakfidgrvafsrmpaereldevardfdavvvlvedyelpysldewekrgvevlhgp
    ipdftapsveqlleilrwieervregkkvlihcmaglgrsgtvgvawlmysrglslreal
    mevrrkrpgavetqeqmevlkeleeriklaaalehh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z5bC (C:)
    mwpsakfidgrvafsrmpaereldevardfdavvvlvedyelpysldewekrgvevlhgp
    ipdftapsveqlleilrwieervregkkvlihcmaglgrsgtvgvawlmysrglslreal
    mevrrkrpgavetqeqmevlkeleeriklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z5bC (C:)
    mwpsakfidgrvafsrmpaereldevardfdavvvlvedyelpysldewekrgvevlhgp
    ipdftapsveqlleilrwieervregkkvlihcmaglgrsgtvgvawlmysrglslreal
    mevrrkrpgavetqeqmevlkeleerikla