PDB entry 5z55

View 5z55 on RCSB PDB site
Description: NMR Solution Structure of the Kringle domain of human receptor tyrosine kinase-like orphan receptor 1 (ROR1)
Class: oncoprotein
Keywords: ROR1, Kringle, ONCOPROTEIN
Deposited on 2018-01-17, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Inactive tyrosine-protein kinase transmembrane receptor ROR1
  Species: Homo sapiens [TaxId:9606]
  Gene: ROR1, NTRKR1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01973 (2-84)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d5z55a1, d5z55a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5z55A (A:)
  gskcynstgvdyrgtvsvtksgrqcqpwnsqyphthtftalrfpelngghsycrnpgnqk
  eapwcftldenfksdlcdipacdsk