PDB entry 5z40

View 5z40 on RCSB PDB site
Description: Crystal structure of pyrrolidone carboxylate peptidase I from Deionococcus radiodurans R1
Class: hydrolase
Keywords: omega peptidase, pyroglutamate, exopeptidase, HYDROLASE
Deposited on 2018-01-09, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) [TaxId:243230]
    Gene: pcp, DR_0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z40a_
  • Chain 'B':
    Compound: Pyrrolidone-carboxylate peptidase
    Species: Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) [TaxId:243230]
    Gene: pcp, DR_0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z40b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z40A (A:)
    mptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrllse
    qdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlplr
    ailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaavalav
    padrpplpylpqseitravrvaaeaitaqssvlqmgkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z40A (A:)
    mptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrllse
    qdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlplr
    ailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaavalav
    padrpplpylpqseitravrvaaeaitaqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z40B (B:)
    mptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrllse
    qdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlplr
    ailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaavalav
    padrpplpylpqseitravrvaaeaitaqssvlqmgkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z40B (B:)
    mptllltgfepfhthpdnpsaqaaqelhglelpggwgvhsallpvephaagaaltrllse
    qdpgavlltglaagrpqvtlervgvgvmdfqipdnagqtyrdqpiepdapaaylatlplr
    ailaawreaeipgdisnsaglyvcnfvlyhalhwlrehgrgavpcgflhvpanaavalav
    padrpplpylpqseitravrvaaeaitaqs