PDB entry 5z3m

View 5z3m on RCSB PDB site
Description: Crystal structure of Low Molecular Weight Phosphotyrosine phosphatase (VcLMWPTP-2) from Vibrio choleraeO395
Class: hydrolase
Keywords: Phosphatase, Ligand Bound, HYDROLASE
Deposited on 2018-01-08, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotyrosine protein phosphatase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_A0440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z3ma_
  • Chain 'B':
    Compound: Phosphotyrosine protein phosphatase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: VC0395_A0440
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z3mb_
  • Heterogens: MPO, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z3mA (A:)
    mkvkglsvlvvctgnlcrspmaeiilrdkirqkrlniqvrsagtlktgktmpddkalqal
    qdygyhpmvnpvqqvtqqdfiehdfiyamdrtnladlldicpaehknklalflskanrqe
    kevpdpyrrsseffqrtalliesgavalvdswqeqginacnenlsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z3mA (A:)
    glsvlvvctgnlcrspmaeiilrdkirqkrlniqvrsagtlktgktmpddkalqalqdyg
    yhpmvnpvqqvtqqdfiehdfiyamdrtnladlldicpaehknklalflskanrqekevp
    dpyrrsseffqrtalliesgavalvdswqeqgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z3mB (B:)
    mkvkglsvlvvctgnlcrspmaeiilrdkirqkrlniqvrsagtlktgktmpddkalqal
    qdygyhpmvnpvqqvtqqdfiehdfiyamdrtnladlldicpaehknklalflskanrqe
    kevpdpyrrsseffqrtalliesgavalvdswqeqginacnenlsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z3mB (B:)
    glsvlvvctgnlcrspmaeiilrdkirqkrlniqvrsagtlktgktmpddkalqalqdyg
    yhpmvnpvqqvtqqdfiehdfiyamdrtnladlldicpaehknklalflskanrqekevp
    dpyrrsseffqrtalliesgavalvdswqeqg