PDB entry 5z3i

View 5z3i on RCSB PDB site
Description: Crystal Structure of Abrin A chain (Recombinant) in complex with Adenine at 1.65 Angstroms
Class: hydrolase
Keywords: Ribosome Inactivating Protein, HYDROLASE
Deposited on 2018-01-08, released 2019-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abrin A-chain
    Species: Abrus precatorius [TaxId:3816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7DM12
      • see sequence details (98)
    Domains in SCOPe 2.08: d5z3ia_
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z3iA (A:)
    mrgshhhhhhgmasedrpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlq
    ernryitvelsnsdtesievgidvtnayvvayragtqshflrdapssasdylftgtdqhs
    lpfygtygdlerwahqsrqqiplglqalthgisffrsggndneekartliviiqmvaeaa
    rfryisnrvrvsiqtgtafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnep
    vivdslshptvavlalmlfvcnppn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z3iA (A:)
    rpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlqernryitvelsnsdte
    sievgidvtnayvvayragtqshflrdapssasdylftgtdqhslpfygtygdlerwahq
    srqqiplglqalthgisffrsggndneekartliviiqmvaeaarfryisnrvrvsiqtg
    tafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnepvivdslshptvavlal
    mlfvcnp