PDB entry 5z38

View 5z38 on RCSB PDB site
Description: Crystal structure of CsrA bound to CesT
Class: RNA binding protein/chaperone
Keywords: EHEC and EPEC, RNA BINDING PROTEIN-CHAPERONE complex
Deposited on 2018-01-05, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CesT protein
    Species: Escherichia coli [TaxId:562]
    Gene: cesT, ERS085406_02303, L537_036, LIHIT_032
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z38a_
  • Chain 'B':
    Compound: CesT protein
    Species: Escherichia coli [TaxId:562]
    Gene: cesT, ERS085406_02303, L537_036, LIHIT_032
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z38b_
  • Chain 'C':
    Compound: CesT protein
    Species: Escherichia coli [TaxId:562]
    Gene: cesT, ERS085406_02303, L537_036, LIHIT_032
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z38c_
  • Chain 'D':
    Compound: CesT protein
    Species: Escherichia coli [TaxId:562]
    Gene: cesT, ERS085406_02303, L537_036, LIHIT_032
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z38d_
  • Chain 'E':
    Compound: Truncated-CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7UHB4 (5-End)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d5z38e1, d5z38e2
  • Chain 'F':
    Compound: wild type CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7UHB4 (10-End)
      • linker (7-9)
    Domains in SCOPe 2.07: d5z38f1, d5z38f2
  • Chain 'G':
    Compound: Truncated-CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7UHB4 (5-End)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d5z38g1, d5z38g2
  • Chain 'H':
    Compound: wild type CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7UHB4 (10-End)
      • linker (9)
    Domains in SCOPe 2.07: d5z38h_
  • Chain 'I':
    Compound: Truncated-CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7UHB4 (5-End)
      • expression tag (0-4)
    Domains in SCOPe 2.07: d5z38i1, d5z38i2
  • Chain 'J':
    Compound: wild type CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z38j_
  • Chain 'K':
    Compound: Truncated-CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7UHB4 (5-End)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d5z38k1, d5z38k2
  • Chain 'L':
    Compound: wild type CsrA
    Species: Escherichia coli O127:H6 str. E2348/69 [TaxId:574521]
    Gene: csrA, E2348C_2959
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z38l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z38A (A:)
    gpmssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkf
    ptdnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvk
    smenlylvlhnqgitlenehmkieeisssdnkhyyagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38A (A:)
    mssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkfpt
    dnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvksm
    enlylvlhnqgitlenehmkieeisssdnkhyya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z38B (B:)
    gpmssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkf
    ptdnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvk
    smenlylvlhnqgitlenehmkieeisssdnkhyyagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38B (B:)
    mssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkfpt
    dnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvksm
    enlylvlhnqgitlenehmkieeisssdnkhyya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z38C (C:)
    gpmssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkf
    ptdnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvk
    smenlylvlhnqgitlenehmkieeisssdnkhyyagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38C (C:)
    mssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkfpt
    dnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvksm
    enlylvlhnqgitlenehmkieeisssdnkhyyag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5z38D (D:)
    gpmssrsellldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkf
    ptdnpnfaleilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvk
    smenlylvlhnqgitlenehmkieeisssdnkhyyagr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38D (D:)
    llldrfaekigvgsisfnenrlcsfaideiyyislsdandeymmiygvcgkfptdnpnfa
    leilnanlwfaenggpylcyesgaqslllalrfplddatpekleneievvvksmenlylv
    lhnqgitlenehmkieeisssdnkhyyagr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5z38E (E:)
    gplgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38E (E:)
    plgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5z38F (F:)
    ggggsggggsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqr
    iqaeksqqssy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38F (F:)
    ggsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaek
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5z38G (G:)
    gplgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38G (G:)
    plgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5z38H (H:)
    ggggsggggsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqr
    iqaeksqqssy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38H (H:)
    smliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaek
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5z38I (I:)
    gplgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38I (I:)
    gplgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5z38J (J:)
    ggggsggggsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqr
    iqaeksqqssy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38J (J:)
    mliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaek
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5z38K (K:)
    gplgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38K (K:)
    plgsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnap
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5z38L (L:)
    ggggsggggsmliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqr
    iqaeksqqssy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z38L (L:)
    liltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaek