PDB entry 5z37

View 5z37 on RCSB PDB site
Description: Crystal Structure of Abrin A chain (Recombinant) at 1.3 Angstroms
Class: hydrolase
Keywords: Ribosome Inactivating Protein, HYDROLASE
Deposited on 2018-01-05, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abrin A-chain
    Species: Abrus precatorius [TaxId:3816]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7DM12
      • see sequence details (98)
    Domains in SCOPe 2.07: d5z37a_
  • Heterogens: IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z37A (A:)
    mrgshhhhhhgmasedrpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlq
    ernryitvelsnsdtesievgidvtnayvvayragtqshflrdapssasdylftgtdqhs
    lpfygtygdlerwahqsrqqiplglqalthgisffrsggndneekartliviiqmvaeaa
    rfryisnrvrvsiqtgtafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnep
    vivdslshptvavlalmlfvcnppn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z37A (A:)
    pikfstegatsqsykqfiealrerlrgglihdipvlpdpttlqernryitvelsnsdtes
    ievgidvtnayvvayragtqshflrdapssasdylftgtdqhslpfygtygdlerwahqs
    rqqiplglqalthgisffrsggndneekartliviiqmvaeaarfryisnrvrvsiqtgt
    afqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnepvivdslshptvavlalm
    lfvcnp