PDB entry 5z2v

View 5z2v on RCSB PDB site
Description: Crystal structure of RecR from Pseudomonas aeruginosa PAO1
Class: DNA binding protein
Keywords: RecR DNA binding homologous recombination, DNA BINDING PROTEIN
Deposited on 2018-01-04, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombination protein recr
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: recR, PA1534
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z2va_
  • Chain 'B':
    Compound: recombination protein recr
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: recR, PA1534
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, GOL, N, PO4, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z2vA (A:)
    msfsplirqlieslrilpgvgqksaqrmalmllerdrsgglklaqaltaamegvghcrqc
    rtlseeelcpqcadprrddsllcvvegpldvfaveqtgyrgryfvlkghlspldglgpea
    igipelearirdgafsevilatnptvegeatahyiaqllagrgltlsriahgvplggele
    lvdggtlahalagrrpis
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2vA (A:)
    fsplirqlieslrilpgvgqksaqrmalmllerdrsgglklaqaltaamegvghcrqcrt
    lseeelcpqcadprrddsllcvvegpldvfaveqtgyrgryfvlkghlspldglgpeaig
    ipelearirdgafsevilatnptvegeatahyiaqllagrgltlsriahgvplggelelv
    dggtlahalagrrpi
    

  • Chain 'B':
    No sequence available.