PDB entry 5z2n

View 5z2n on RCSB PDB site
Description: Structure of Orp1L N-terminal Domain
Class: endocytosis
Keywords: GTPase, Effector, Complex, ENDOCYTOSIS
Deposited on 2018-01-03, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxysterol-binding protein-related protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Osbpl1a, Orp1, Orp1a, Orp1l
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z2na_
  • Chain 'B':
    Compound: Oxysterol-binding protein-related protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Osbpl1a, Orp1, Orp1a, Orp1l
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z2nb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z2nA (A:)
    mnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyfgh
    kqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtakea
    thdkeirnmleavert
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2nA (A:)
    mnteaeqqllhharngnaeevrkllaamarmevvadidckgrslgwtplhlacyfghkqv
    vedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtakeathd
    keirnmleavert
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z2nB (B:)
    mnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyfgh
    kqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtakea
    thdkeirnmleavert