PDB entry 5z2m

View 5z2m on RCSB PDB site
Description: Structure of Orp1L/Rab7 complex
Class: endocytosis
Keywords: GTPase, Effector, Complex, ENDOCYTOSIS
Deposited on 2018-01-03, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-7a
    Species: Mus musculus [TaxId:10090]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51150 (Start-175)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5z2ma_
  • Chain 'B':
    Compound: Oxysterol-binding protein-related protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Osbpl1a, Orp1, Orp1a, Orp1l
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XL9 (2-137)
      • expression tag (1)
    Domains in SCOPe 2.07: d5z2mb1, d5z2mb2
  • Chain 'C':
    Compound: Ras-related protein Rab-7a
    Species: Mus musculus [TaxId:10090]
    Gene: RAB7A, RAB7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51150
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5z2mc_
  • Chain 'D':
    Compound: Oxysterol-binding protein-related protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Osbpl1a, Orp1, Orp1a, Orp1l
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91XL9 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5z2md1, d5z2md2
  • Heterogens: MG, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z2mA (A:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2mA (A:)
    kkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdt
    aglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlg
    nkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z2mB (B:)
    gsmnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyf
    ghkqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtak
    eathdkeirnmleavert
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2mB (B:)
    smnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyfg
    hkqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtake
    athdkeirnmleavert
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5z2mC (C:)
    mtsrkkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmq
    iwdtaglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpf
    vvlgnkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2mC (C:)
    kkvllkviilgdsgvgktslmnqyvnkkfsnqykaadfltkevmvddrlvtmqiwdtagl
    erfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnki
    dlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5z2mD (D:)
    gsmnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyf
    ghkqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtak
    eathdkeirnmleavert
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z2mD (D:)
    gsmnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyf
    ghkqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtak
    eathdkeirnmleave