PDB entry 5z1d

View 5z1d on RCSB PDB site
Description: MAP2K7 C276S mutant-inhibitor
Class: transferase
Keywords: protein kinase, TRANSFERASE
Deposited on 2017-12-26, released 2019-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.2800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 7
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K7, JNKK2, MEK7, MKK7, PRKMK7, SKK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14733 (1-End)
      • conflict (158)
    Domains in SCOPe 2.08: d5z1da_
  • Heterogens: 95U, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z1dA (A:)
    mtgyltiggqryqaeindlenlgemgsgtcgqvwkmrfrktghviavkqmrrsgnkeenk
    rilmdldvvlkshdcpyivqcfgtfitntdvfiamelmgtcaeklkkrmqgpiperilgk
    mtvaivkalyylkekhgvihrdvkpsnilldergqiklsdfgisgrlvdskaktrsagca
    aymaperidppdptkpdydiradvwslgislvelatgqfpykncktdfevltkvlqeepp
    llpghmgfsgdfqsfvkdcltkdhrkrpkynkllehsfikryetlevdvaswfkdvmakt
    esprtsgvlsqphlpffrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z1dA (A:)
    tgyltiggqryqaeindlenlgemgqvwkmrfrktghviavkqmrrsgnkeenkrilmdl
    dvvlkshdcpyivqcfgtfitntdvfiamelmgtcaeklkkrmqgpiperilgkmtvaiv
    kalyylkekhgvihrdvkpsnilldergqiklsdfgisgcaaymaperidppradvwslg
    islvelatgqfpykncktdfevltkvlqeeppllpghmgfsgdfqsfvkdcltkdhrkrp
    kynkllehsfikryetlevdvaswfkdvmaktes