PDB entry 5z0y

View 5z0y on RCSB PDB site
Description: Crystallization and structure determination of cytoplasm serine hydroxymethyltransferase (SHMT) from Pichia pastoris
Class: transferase
Keywords: SHMT, pichia pastoris, cytoplasm serine hydroxymethyltransferase, TRANSFERASE
Deposited on 2017-12-22, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) [TaxId:981350]
    Gene: SHM2, PP7435_Chr4-0570
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z0ya_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z0yA (A:)
    mshyalspehkqmveghlaetdpevnqiikdevdrqkhsivliasenftstsvfdalgtp
    mcnkysegypgaryyggnehidrmeilcqqralkafhldgsrwgvnvqtlsgspanlqvy
    qaimkphdrlmgldlphgghlshgyqtdtrkisavstyfetmpyrvdletgiidydmlek
    tavlyrpkvlvagtsaycrlidykrmreiadkvgaylvvdmahisgliaagvipspfeya
    divtttthkslrgprgamiffrkgvrsvnpktgkeiyydlenpinfsvfpghqggphnht
    iaalatalkqaatpefkqyqeqvlknakalenefkrlgyklvsdgtdshmvlvslkdkdi
    dgarietvceninialnknsipgdrsalvpggvrigapamttrgaseedfvkianyidks
    vqyakkvqselpieanklkdfkakiaegsdeitqlkneisawagefplsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z0yA (A:)
    etdpevnqiikdevdrqkhsivlidrmeilcqqralkafhldgsrwgvnvqtlspanlqv
    yqaimkphdrlmgldlphtyfetmpyrvdletgiidydmlektavlyrpkvlvagtsayc
    rlidykrmreiadkvgaylvvdmahisgliaagvipspfeyadivtttthkslrgprgam
    iffrkgvrsyydlenpinfsvhtiaalatalkqaatpefkqyqeqvlknakalenefkrl
    gyklvsdgtdshmvlvslkdkdidgarietvceninialnknsipgdrsalvpggvriga
    pamttrgaseedfvkianyidksvqyakkvqselpieanklkdfkakiaegsdeitqlkn
    eisawagefpls