PDB entry 5z0x

View 5z0x on RCSB PDB site
Description: X-ray Crystal Structure of Pseudoazurin Met16Tyr Variant
Class: electron transport
Keywords: electron transport
Deposited on 2017-12-22, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5z0xa_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (15)
    Domains in SCOPe 2.07: d5z0xb_
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z0xA (A:)
    adfevhmlnkgkdgayvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5z0xB (B:)
    adfevhmlnkgkdgayvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn