PDB entry 5z02

View 5z02 on RCSB PDB site
Description: Crystal structure of HIS6-tagged Mdm2 with nutlin-3a
Class: oncoprotein
Keywords: inhibitor; E3-ligase, ONCOPROTEIN
Deposited on 2017-12-18, released 2018-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-03, with a file datestamp of 2017-12-29.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5z02a_
  • Heterogens: NUT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z02A (A:)
    gsshhhhhhsqdlenlyfqgsqetlvrpkplllkllksvgaqkdtytmkevlfylgqyim
    tkrlydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z02A (A:)
    qetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllg
    dlfgvpsfsvkehrkiytmiyrnlvvvn