PDB entry 5yzw

View 5yzw on RCSB PDB site
Description: Crystal structure of p204 HINb domain
Class: immune system
Keywords: Interferon inducible gene 204, IFI204, DNA sensor, PYHIN family, IMMUNE SYSTEM
Deposited on 2017-12-15, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ifi204
    Species: Mus musculus domesticus [TaxId:10092]
    Gene: Ifi204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yzwa1, d5yzwa2, d5yzwa3
  • Chain 'B':
    Compound: Ifi204
    Species: Mus musculus domesticus [TaxId:10092]
    Gene: Ifi204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yzwb1, d5yzwb2, d5yzwb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yzwA (A:)
    gsvddhhhgpkqvmvlkvtepftydlkedkrmfhatvateteffrvkvfdtalkskfipr
    niiaisdyfgcngfleiyrascvsdvnvnptmvisntlrqranatpkisylfsqargtfv
    sgeylvnkkternkfiyygigddtgkmevvvygrltnvrcepgsklrlvcfeltstedgw
    qlrsvrhsymqvinarkaaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yzwA (A:)
    vddhhhgpkqvmvlkvtepftydlkedkrmfhatvateteffrvkvfdtalkskfiprni
    iaisdyfgcngfleiyrascvsdvnvnptmvisntlrqranatpkisylfsqargtfvsg
    eylvnkkternkfiyygigddtgkmevvvygrltnvrcepgsklrlvcfeltstedgwql
    rsvrhsymqvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yzwB (B:)
    gsvddhhhgpkqvmvlkvtepftydlkedkrmfhatvateteffrvkvfdtalkskfipr
    niiaisdyfgcngfleiyrascvsdvnvnptmvisntlrqranatpkisylfsqargtfv
    sgeylvnkkternkfiyygigddtgkmevvvygrltnvrcepgsklrlvcfeltstedgw
    qlrsvrhsymqvinarkaaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yzwB (B:)
    gsvddhhhgpkqvmvlkvtepftydlkedkrmfhatvateteffrvkvfdtalkskfipr
    niiaisdyfgcngfleiyrascvsdvnvnptmvisntlrqranatpkisylfsqargtfv
    sgeylvnkkternkfiyygigddtgkmevvvygrltnvrcepgsklrlvcfeltstedgw
    qlrsvrhsymqvi