PDB entry 5yzp

View 5yzp on RCSB PDB site
Description: Crystal structure of p204 HINa domain
Class: immune system
Keywords: DNA sensor, pattern recognition receptors, type I-IFN, PYHIN family, AIM-2 like receptors, IMMUNE SYSTEM
Deposited on 2017-12-15, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ifi204
    Species: Mus musculus domesticus [TaxId:10092]
    Gene: Ifi204
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yzpa1, d5yzpa2
  • Heterogens: EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yzpA (A:)
    gsvdqniprgavlhsepltvmvltatdpfeyespehevknmlhatvatvsqyfhvkvfni
    nlkekftkknfiiisnyfeskgileinetssvleaapdqmievpnsiirnanaspkicdi
    qkgtsgavfygvftlhkktvnrkntiyeikdgsgsievvgsgkwhninckegdklhlfcf
    hlktidrqpklvcgehsfikiskrgnaaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yzpA (A:)
    gavlhsepltvmvltatdpfeyespehevknmlhatvatvsqyfhvkvfninlkekftkk
    nfiiisnyfeskgileinetssvleaapdqmievpnsiirnanaspkicdiqkgtsgavf
    ygvftlhkktvnrkntiyeikdgsgsievvgsgkwhninckegdklhlfcfhlktidrqp
    klvcgehsfikiskr