PDB entry 5yzi

View 5yzi on RCSB PDB site
Description: Crystal Structure of Mouse Cytosolic Isocitrate Dehydrogenase complexed with Cadmium
Class: oxidoreductase
Keywords: idh, oxidoreductase
Deposited on 2017-12-14, released 2018-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yzia_
  • Chain 'B':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Gene: IDH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yzib_
  • Heterogens: CD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yziA (A:)
    msrkiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkda
    aeaikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vtgwvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfe
    aqkicyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakale
    dvcietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yziA (A:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqk
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yziB (B:)
    msrkiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkda
    aeaikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vtgwvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfe
    aqkicyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakale
    dvcietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yziB (B:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqk
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaq