PDB entry 5yzf

View 5yzf on RCSB PDB site
Description: X-ray crystal structure of met K42C sperm whale myoglobin
Class: oxygen transport
Keywords: myoglobin, OXYGEN TRANSPORT
Deposited on 2017-12-14, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sperm whale myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d5yzfa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yzfA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlecfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg