PDB entry 5yy5

View 5yy5 on RCSB PDB site
Description: Structural definition of a unique neutralization epitope on the receptor-binding domain of MERS-CoV spike glycoprotein
Class: viral protein
Keywords: MERS-CoV, spike glycorptotein, neutralizing antibody, VIRAL PROTEIN
Deposited on 2017-12-08, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MERS-CoV RBD
  Species: Middle East respiratory syndrome coronavirus [TaxId:1335626]
  Database cross-references and differences (RAF-indexed):
  • PDB 5YY5 (0-208)
• Chain 'B':
  Compound: MERS-CoV RBD
  Species: Middle East respiratory syndrome coronavirus [TaxId:1335626]
  Database cross-references and differences (RAF-indexed):
  • PDB 5YY5 (0-208)
• Chain 'C':
  Compound: heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5YY5 (0-108)
  Domains in SCOPe 2.07: d5yy5c_
• Chain 'D':
  Compound: light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5YY5 (0-104)
  Domains in SCOPe 2.07: d5yy5d_
• Chain 'H':
  Compound: heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5YY5 (0-99)
  Domains in SCOPe 2.07: d5yy5h_
• Chain 'L':
  Compound: light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5YY5 (0-111)
• Heterogens: NAG

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yy5C (C:)
  gvqlvesggglvqpgrslrlscaasgftfsnyamywvrqapgkglewvalisydistdyy
  adsvkgrftisrdnskntiylqmnnlrtedtalyyctntyywgqgtlvt
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yy5D (D:)
  ltqspsasgtpgqrvtiscsgsssnignnyvywyqqlpgtapklliywndqrpsgvpdrf
  sgsksgtsaslaisglrsedeadyycaawddslsgavfgggtqlt
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5yy5H (H:)
  evqlvesggglvqpgrslrlscaasgftfsnyamywvrqapgkglewvalisydistdyy
  adsvkgrftisrdnskntiylqmnnlrtedtalyyctntyywgqgtlvtvs
  

  
  
• Chain 'L':
  No sequence available.