PDB entry 5yxm

View 5yxm on RCSB PDB site
Description: Crystal structure of Chlamydomonas Outer Arm Dynein Light Chain 1
Class: contractile protein
Keywords: motor protein, contractile protein
Deposited on 2017-12-06, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 1, axonemal
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: LC1, CHLREDRAFT_186669
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yxma_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yxmA (A:)
    gplgsmakattikdairifeerksvvateaekvelhgmippiekmdatlstlkackhlal
    stnniekisslsgmenlrilslgrnlikkienldavadtleelwisynqiaslsgieklv
    nlrvlymsnnkitnwgeidklaaldkledlllagnplyndykennatseyrievvkrlpn
    lkkldgmpvdvdereqanvargg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxmA (A:)
    kattikdairifeerksvvateaekvelhgmippiekmdatlstlkackhlalstnniek
    isslsgmenlrilslgrnlikkienldavadtleelwisynqiaslsgieklvnlrvlym
    snnkitnwgeidklaaldkledlllagnplyndykennatseyrievvkrlpnlkkldgm
    pvdvdereqanvar