PDB entry 5yxc

View 5yxc on RCSB PDB site
Description: Crystal structure of Zinc binding protein ZinT in complex with citrate from E. coli
Class: metal binding protein
Keywords: Zinc binding protein, complex, citrate, METAL BINDING PROTEIN
Deposited on 2017-12-04, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metal-binding protein zint
    Species: Escherichia coli [TaxId:83333]
    Gene: zinT, yodA, b1973, JW1956
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yxca_
  • Chain 'B':
    Compound: metal-binding protein zint
    Species: Escherichia coli [TaxId:83333]
    Gene: zinT, yodA, b1973, JW1956
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yxcb_
  • Heterogens: ZN, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yxcA (A:)
    mairlyklavalgvfivsapafshghhshgkplteveqkaangvfddanvqnrtlsdwdg
    vwqsvypllqsgkldpvfqkkadadktktfaeikdyyhkgyatdiemigiedgivefhrn
    nettsckydydgykiltyksgkkgvrylfeckdpeskapkyiqfsdhiiaprksshfhif
    mgndsqqsllnemenwptyypyqlsseevveemmsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxcA (A:)
    gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
    faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
    eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
    veemmsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yxcB (B:)
    mairlyklavalgvfivsapafshghhshgkplteveqkaangvfddanvqnrtlsdwdg
    vwqsvypllqsgkldpvfqkkadadktktfaeikdyyhkgyatdiemigiedgivefhrn
    nettsckydydgykiltyksgkkgvrylfeckdpeskapkyiqfsdhiiaprksshfhif
    mgndsqqsllnemenwptyypyqlsseevveemmsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yxcB (B:)
    gkplteveqkaangvfddanvqnrtlsdwdgvwqsvypllqsgkldpvfqkkadadktkt
    faeikdyyhkgyatdiemigiedgivefhrnnettsckydydgykiltyksgkkgvrylf
    eckdpeskapkyiqfsdhiiaprksshfhifmgndsqqsllnemenwptyypyqlsseev
    veemmsh