PDB entry 5yx6

View 5yx6 on RCSB PDB site
Description: Crystal structure of Rv3272 from M. tuberculosis orthorhombic form
Class: transferase
Keywords: Rv3272, CoA transferase, fatty acid metabolism, tuberculosis, Transferase
Deposited on 2017-12-01, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Rv3272
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx6a_
  • Chain 'B':
    Compound: Uncharacterized protein Rv3272
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx6b_
  • Chain 'C':
    Compound: Uncharacterized protein Rv3272
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx6c_
  • Chain 'D':
    Compound: Uncharacterized protein Rv3272
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv3272
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yx6d_
  • Heterogens: BAM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yx6A (A:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yx6A (A:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrpplat
    yflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpn
    liyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaq
    avlaallhrerngvadvvqvamydvavglqanqlmmhlnrtqpsdafrtadgyivisayv
    pkhwqklcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqangl
    maclahtwkqvvdtplfaendltlevgtitvirtparyasfravvtdppptagehnavfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yx6B (B:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yx6B (B:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitlatyflpnnrg
    kksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarlta
    yggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaallh
    rerngvadvvqvamydvavglqanqlmmhlnrtqpsdafrtadgyivisayvpkhwqklc
    yligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclahtw
    kqvvdtplfaendltlevgrgadtitvirtparyasfravvtdppptagehnavfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yx6C (C:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yx6C (C:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsplatyflpnn
    rgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarl
    tayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaal
    lhrerngvadvvqvamydvavglqanqlmmhlnrtqpsdafrtadgyivisayvpkhwqk
    lcyligrpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclah
    twkqvvdtplfaendltlevtitvirtparyasfravvtdppptagehnavflar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yx6D (D:)
    mptsnpakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqitsvlpgrp
    platyflpnnrgkksvtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrs
    rnpnliyarltayggngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasgh
    vlaqavlaallhrerngvadvvqvamydvavglqanqlmmhlnraasdqpkpepapkakr
    rkgvgfatqpsdafrtadgyivisayvpkhwqklcyligrpdlvedqrfaeqrsrsinya
    eltaelelalasktatewvqllqanglmaclahtwkqvvdtplfaendltlevgrgadti
    tvirtparyasfravvtdppptagehnavflarp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yx6D (D:)
    npakpldgfrvldftqnvagplagqvlvdlgaevikveapggeaarqityflpnnrgkks
    vtvdltteqakqqmlrladtadvvleafrpgtmeklglgpddlrsrnpnliyarltaygg
    ngphgsrpgidlvvaaeagmttgmptpegkpqiipfqlvdnasghvlaqavlaallhrer
    ngvadvvqvamydvavglqanqlmmhlntqpsdafrtadgyivisayvpkhwqklcylig
    rpdlvedqrfaeqrsrsinyaeltaelelalasktatewvqllqanglmaclahtwkqvv
    dtplfaendltlevgrgadtitvirtparyasfravvtdppptagehnavfla