PDB entry 5ywr

View 5ywr on RCSB PDB site
Description: Crystal Structure of RING E3 ligase ZNRF1 in complex with Ube2N (Ubc13)
Class: signaling protein
Keywords: Ubiquitin E3 ligase, ZNRF1, Ubiquitin Conjugating E2, Ube2N, Ubc13, SIGNALING PROTEIN
Deposited on 2017-11-30, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2N, BLU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywra_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase ZNRF1
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNRF1, NIN283
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, PGE, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ywrA (A:)
    maglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpe
    eypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddp
    landvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ywrA (A:)
    glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
    pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
    ndvaeqwktneaqaietarawtrlyamnni
    

  • Chain 'B':
    No sequence available.