PDB entry 5ywn

View 5ywn on RCSB PDB site
Description: SsCR_L211H-NADP+
Class: oxidoreductase
Keywords: reductase, asymmetric reduction, substrate inhibition, OXIDOREDUCTASE
Deposited on 2017-11-29, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein induced by osmotic stress
    Species: Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) [TaxId:322104]
    Gene: GRP3.1, PICST_32463
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3LWG4 (0-End)
      • engineered mutation (210)
    Domains in SCOPe 2.07: d5ywna_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ywnA (A:)
    mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
    kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
    vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
    ekpnfalstvnpvyifgpqakdeevkgtlnhsaemvnsvlklnkdddvpattgtfidvrd
    vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
    ewndkktkkilgfeyfdfetsvvdsikqvlkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ywnA (A:)
    mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
    kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
    vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
    ekpnfalstvnpvyifgpqakdeevkgtlnhsaemvnsvlklnkdddvpattgtfidvrd
    vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
    ewndkktkkilgfeyfdfetsvvdsikqvlkvq