PDB entry 5ywm

View 5ywm on RCSB PDB site
Description: Crystal structure of CK2a2 form-1
Class: transferase
Keywords: Protein kinase, TRANSFERASE
Deposited on 2017-11-29, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Casein kinase II subunit alpha'
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A2, CK2A2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywmx_
  • Heterogens: SO4, NIO, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5ywmX (X:)
    gplgsmpgpaagsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgrgkysevf
    eainitnnervvvkilkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfe
    yinntdfkqlyqiltdfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrli
    dwglaefyhpaqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffh
    gqdnydqlvriakvlgteelygylkkyhidldphfndilgqhsrkrwenfihsenrhlvs
    pealdlldkllrydhqqrltakeamehpyfypvvkeqsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ywmX (X:)
    gsrarvyaevnslrsreywdyeahvpswgnqddyqlvrklgsevfeainitnnervvvki
    lkpvkkkkikrevkilenlrggtniiklidtvkdpvsktpalvfeyinntdfkqlyqilt
    dfdirfymyellkaldychskgimhrdvkphnvmidhqqkklrlidwglaefyhpaqeyn
    vrvasryfkgpellvdyqmydysldmwslgcmlasmifrrepffhgqdnydqlvriakvl
    gteelygylkkyhidldlgqhsrkrwenfihsenrhlvspealdlldkllrydhqqrlta
    keamehpyfypvv