PDB entry 5ywk

View 5ywk on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana HPPD complexed with Benquitrione-Methyl
Class: oxidoreductase
Keywords: 4-hydroxyphenylpyruvate dioxygenase, Herbicide, drug discovery, OXIDOREDUCTASE
Deposited on 2017-11-29, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, PDS1, At1g06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywka1, d5ywka2
  • Chain 'B':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, PDS1, At1g06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ywkb1, d5ywkb2
  • Heterogens: CO, 92X, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ywkA (A:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ywkA (A:)
    fskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasy
    lltsgdlrflftapyspslsttasipsfdhgscrsffsshglgvravaievedaesafsi
    svangaipssppivlneavtiaevklygdvvlryvsykaflpgfervedasfpldygirr
    ldhavgnvpelgpaltyvagftgfhqfaefesglnsavlasndemvllpinepvhgksqi
    qtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvl
    sddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmqsggcggfgkg
    nfselfksieey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ywkB (B:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ywkB (B:)
    fskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasy
    lltsgdlrflftapyspslttasipsfdhgscrsffsshglgvravaievedaesafsis
    vangaipssppivlneavtiaevklygdvvlryvsykaflpgfervedaspldygirrld
    havgnvpelgpaltyvagftgfhqfaefsglnsavlasndemvllpinepvksqiqtyle
    hnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqi
    keceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfse
    lfksieey