PDB entry 5ywf

View 5ywf on RCSB PDB site
Description: Crystal structure of 2H4 Fab
Class: immune system
Keywords: Flaviviruses, Viral encephalitis, neutralizing monoclonal antibodies, structural analysis, viral entry, IMMUNE SYSTEM
Deposited on 2017-11-29, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2H4 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YWF (0-214)
    Domains in SCOPe 2.07: d5ywfa1, d5ywfa2
  • Chain 'B':
    Compound: 2H4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YWF (0-217)
  • Chain 'C':
    Compound: 2H4 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YWF (0-214)
    Domains in SCOPe 2.07: d5ywfc1, d5ywfc2
  • Chain 'D':
    Compound: 2H4 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YWF (0-217)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ywfA (A:)
    divltqspaslavslgqratiscrasqsvstsymhwyqqkpgqpprlliylvsnlesgvp
    srfsgsgsgtdftlnihpveaedeatyycqhireltrseagpswleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ywfC (C:)
    divltqspaslavslgqratiscrasqsvstsymhwyqqkpgqpprlliylvsnlesgvp
    srfsgsgsgtdftlnihpveaedeatyycqhireltrseagpswleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    No sequence available.