PDB entry 5yw4

View 5yw4 on RCSB PDB site
Description: Structure-Guided Engineering of Reductase: Efficient Attenuating Substrate Inhibition in Asymmetric Catalysis
Class: oxidoreductase
Keywords: reductase, NADP+, asymmetric catalysis, OXIDOREDUCTASE
Deposited on 2017-11-28, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein induced by osmotic stress
    Species: Scheffersomyces stipitis [TaxId:322104]
    Gene: GRP3.1, PICST_32463
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yw4a_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yw4A (A:)
    mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
    kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
    vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
    ekpnfalstvnpvyifgpqakdeevkgtlnlsaemvnsvlklnkdddvpattgtfidvrd
    vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
    ewndkktkkilgfeyfdfetsvvdsikqvlkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yw4A (A:)
    mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
    kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
    vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
    ekpnfalstvnpvyifgpqakdeevkgtlnlsaemvnsvlklnkdddvpattgtfidvrd
    vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
    ewndkktkkilgfeyfdfetsvvdsikqvlk