PDB entry 5yvu

View 5yvu on RCSB PDB site
Description: Crystal structures of unlinked full length NS3 from Dengue virus provide insights into dynamics of protease domain
Class: viral protein
Keywords: serine protease, non-structural protein 3, deah helicase, flavivirus, dengue, viral protein
Deposited on 2017-11-27, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: DENGUE VIRUS 4 [TaxId:11070]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Genome polyprotein
    Species: DENGUE VIRUS 4 [TaxId:11070]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F8TEL4 (Start-626)
      • engineered mutation (143)
  • Chain 'I':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yvui_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yvuI (I:)
    rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtc