PDB entry 5yvo

View 5yvo on RCSB PDB site
Description: Human Glutathione Transferase Omega1 covalently bound to ML175 inhibitor
Class: transferase
Keywords: Inhibitor, GST, allosteric, TRANSFERASE
Deposited on 2017-11-27, released 2018-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase omega-1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTO1, GSTTLP28
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yvoa1, d5yvoa2
  • Heterogens: SO4, ACT, MLX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yvoA (A:)
    msgesarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkp
    ewffkknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelf
    skvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkttffggnsismidyliwpw
    ferleamklnecvdhtpklklwmaamkedptvsalltsekdwqgflelylqnspeacdyg
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yvoA (A:)
    gesarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpew
    ffkknpfglvpvlensqgqliyesaitceyldeaypgkkllpddpyekacqkmilelfsk
    vpslvgsfirsqnkedyaglkeefrkeftkleevltnkkttffggnsismidyliwpwfe
    rleamklnecvdhtpklklwmaamkedptvsalltsekdwqgflelylqnspeacdygl