PDB entry 5yvi

View 5yvi on RCSB PDB site
Description: Crystal structure of Karyopherin beta2 in complex with FUS(456-526)
Class: protein transport/RNA binding protein
Keywords: Importin family, PROTEIN TRANSPORT, PROTEIN TRANSPORT-RNA BINDING PROTEIN complex
Deposited on 2017-11-25, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: TNPO1, KPNB2, MIP1, TRN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yvia_
  • Chain 'B':
    Compound: RNA-binding protein FUS
    Species: Homo sapiens [TaxId:9606]
    Gene: FUS, TLS
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yviA (A:)
    gsmeyewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklk
    sedeptrslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittia
    skgelqnwpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipk
    flqffkhsspkirshavacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcra
    lvmllevrmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlp
    klipvlvngmkysdidiillkgdveedetipdseqdirggsggsgdtisdwnlrkcsaaa
    ldvlanvyrdellphilpllkellfhhewvvkesgilvlgaiaegcmqgmipylpeliph
    liqclsdkkalvrsitcwtlsryahwvvsqppdtylkplmtellkrildsnkrvqeaacs
    afatleeeactelvpylayildtlvfafskyqhknllilydaigtladsvghhlnkpeyi
    qmlmppliqkwnmlkdedkdlfplleclssvatalqsgflpycepvyqrcvnlvqktlaq
    amlnnaqpdqyeapdkdfmivaldllsglaeglggnieqlvarsniltlmyqcmqdkmpe
    vrqssfallgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatwaigeisiqmgie
    mqpyipmvlhqlveiinrpntpktllentaitigrlgyvcpqevapmlqqfirpwctslr
    nirdneekdsafrgictmisvnpsgviqdfiffcdavaswinpkddlrdmfckilhgfkn
    qvgdenwrrfsdqfplplkerlaafygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yviA (A:)
    ewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksedep
    trslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskgel
    qnwpdllpklcslldsedyntcegafgalqkicedsaeildsldrplnimipkflqffkh
    sspkirshavacvnqfiisrtqalmlhidsfienlfalagdeepevrknvcralvmllev
    rmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipvlv
    ngmkysdidiilldwnlrkcsaaaldvlanvyrdellphilpllkellfhhewvvkesgi
    lvlgaiaegcmqgmipylpeliphliqclsdkkalvrsitcwtlsryahwvvsqppdtyl
    kplmtellkrildsnkrvqeaacsafatleeeactelvpylayildtlvfafskyqhknl
    lilydaigtladsvghhlnkpeyiqmlmppliqkwnmlkdedkdlfplleclssvatalq
    sgflpycepvyqrcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsglaeglggn
    ieqlvarsniltlmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfmpilgtnln
    pefisvcnnatwaigeisiqmgiemqpyipmvlhqlveiinrpntpktllentaitigrl
    gyvcpqevapmlqqfirpwctslrnirdneekdsafrgictmsvnpsgviqdfiffcdav
    aswinpkddlrdmfckilhgfknqenwrrfsdqfplplkerlaafygv
    

  • Chain 'B':
    No sequence available.