PDB entry 5yvd

View 5yvd on RCSB PDB site
Description: Structural and biochemical characterization of endoribonuclease Nsp15 encoded by Middle East Respiratory Syndrome Coronavirus
Class: hydrolase
Keywords: MERS-CoV, anti-viral, endoribonuclease, HYDROLASE
Deposited on 2017-11-24, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nsp15
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U2GPI9 (0-End)
      • conflict (122)
      • conflict (253)
    Domains in SCOPe 2.07: d5yvda1, d5yvda2
  • Chain 'B':
    Compound: Nsp15
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0U2GPI9 (0-End)
      • conflict (122)
      • conflict (253)
    Domains in SCOPe 2.07: d5yvdb1, d5yvdb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yvdA (A:)
    gleniafnvvkqghfigvegelpvavvndkiftksgvndicmfenkttlptniafelyak
    ravrshpdfkllhnlqadicykfvlwdyersniygtatigvckytdidvnsalnicfdir
    dncslekfmstpnaifisdrkikkypcmvgpdyayfngaiirdsdvvkqpvkfylykkvn
    nefidpteciytqsrscsdflplsdmekdflsfdsdvfikkyglenyafehvvygdfsht
    tlgglhlliglykrqqeghiimeemlkgsstihnyfitetntaafkavcsvidlklddfv
    milksqdlgvvskvvkvpidltmiefmlwckdgqvqtfyprlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yvdA (A:)
    gleniafnvvkqghfigvegelpvavvndkiftksgvndicmfenkttlptniafelyak
    ravrshpdfkllhnlqadicykfvlwdyersniygtatigvckytdidvnsalnicfdir
    dncslekfmstpnaifisdrkikkypcmvgpdyayfngaiirdsdvvkqpvkfylykkvn
    nefidpteciytqsrscsdflplsdmekdflsfdsdvfikkyglenyafehvvygdfsht
    tlgglhlliglykrqqeghiimeemlkgsstihnyfitetntaafkavcsvidlklddfv
    milksqdlgvvskvvkvpidltmiefmlwckdgqvqtfypr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yvdB (B:)
    gleniafnvvkqghfigvegelpvavvndkiftksgvndicmfenkttlptniafelyak
    ravrshpdfkllhnlqadicykfvlwdyersniygtatigvckytdidvnsalnicfdir
    dncslekfmstpnaifisdrkikkypcmvgpdyayfngaiirdsdvvkqpvkfylykkvn
    nefidpteciytqsrscsdflplsdmekdflsfdsdvfikkyglenyafehvvygdfsht
    tlgglhlliglykrqqeghiimeemlkgsstihnyfitetntaafkavcsvidlklddfv
    milksqdlgvvskvvkvpidltmiefmlwckdgqvqtfyprlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yvdB (B:)
    gleniafnvvkqghfigvegelpvavvndkiftksgvndicmfenkttlptniafelyak
    ravrshpdfkllhnlqadicykfvlwdyersniygtatigvckytdidvnsalnicfdir
    dncslekfmstpnaifisdrkikkypcmvgpdyayfngaiirdsdvvkqpvkfylykkvn
    nefidpteciytqsrscsdflplsdmekdflsfdsdvfikkyglenyafehvvygdfsht
    tlgglhlliglykrqqeghiimeemlkgsstihnyfitetntaafkavcsvidlklddfv
    milksqdlgvvskvvkvpidltmiefmlwckdgqvqtfypr