PDB entry 5yvc

View 5yvc on RCSB PDB site
Description: A kinase-inhibitor complex
Class: transferase
Keywords: calcium/calmodulin-dependent protein kinase kinase 2, camkk2, ATP-binding, kinase, serine/threonine-protein kinase, transferase, protein-inhibitor complex
Deposited on 2017-11-24, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK2, CAMKKB, KIAA0787
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yvca_
  • Heterogens: SU6, GOL, PGE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yvcA (A:)
    gssgssgdcvqlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqagfprr
    ppprgtrpapggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhlymvfelv
    nqgpvmevptlkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedghikiad
    fgvsnefkgsdallsntvgtpafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpf
    mderimclhskiksqalefpdqpdiaedlkdlitrmldknpesrivvpeiklhpwvtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yvcA (A:)
    vqlnqytlkdeigkgsygvvklaynendntyyamkvlskkpieqvyqeiailkkldhpnv
    vklvevlddpnedhlymvfelvnqgpvmevptlkplsedqarfyfqdlikgieylhyqki
    ihrdikpsnllvgedghikiadfgvsnefkgsdallsntvgtpafmapeslsetrkifsg
    kaldvwamgvtlycfvfgqcpfmderimclhskiksqalefpdqpdiaedlkdlitrmld
    knpesrivvpeiklhpwvtr