PDB entry 5yv8

View 5yv8 on RCSB PDB site
Description: Structure of CaMKK2 in complex with CKI-002
Class: transferase
Keywords: ATP-binding, kinase, serine/threonine-protein kinase, transferase, protein-inhibitor complex
Deposited on 2017-11-24, released 2018-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMKK2, CAMKKB, KIAA0787
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yv8a_
  • Heterogens: 91L, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yv8A (A:)
    gssgssgdcvqlnqytlkdeigkgsygvvklaynendntyyamkvlskkklirqagfprr
    ppprgtrpapggciqprgpieqvyqeiailkkldhpnvvklvevlddpnedhlymvfelv
    nqgpvmevptlkplsedqarfyfqdlikgieylhyqkiihrdikpsnllvgedghikiad
    fgvsnefkgsdallsntvgtpafmapeslsetrkifsgkaldvwamgvtlycfvfgqcpf
    mderimclhskiksqalefpdqpdiaedlkdlitrmldknpesrivvpeiklhpwvtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yv8A (A:)
    vqlnqytlkdeigkgsygvvklaynendntyyamkvlskkpieqvyqeiailkkldhpnv
    vklvevlddpnedhlymvfelvnqgpvmevptlkplsedqarfyfqdlikgieylhyqki
    ihrdikpsnllvgedghikiadfgvsnefkgsdallsntvgtpafmapeslsetrkifsg
    kaldvwamgvtlycfvfgqcpfmderimclhskiksqalefpdqpdiaedlkdlitrmld
    knpesrivvpeiklhpwvtr