PDB entry 5yup

View 5yup on RCSB PDB site
Description: Crystal Structure of the Fab fragment of FVIIa antibody mAb4F5
Class: immune system
Keywords: FVIIa, antibodies, Fab4F5, inhibition, coagulation, STRUCTURAL PROTEIN, IMMUNE SYSTEM
Deposited on 2017-11-22, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: the heavy chain of the Fab fragment of FVIIa antibody mAb4F5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YUP (0-218)
  • Chain 'L':
    Compound: the light chain of the Fab fragment of FVIIa antibody mAb4F5
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YUP (0-214)
    Domains in SCOPe 2.07: d5yupl1, d5yupl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yupL (L:)
    divmtqshkflstsvgnrvsitckasqdvgiglvswyqqkpgqspkllihwastrhtgvp
    drftgsgsgtdftltinnvqsedlatyfcqqfsnypltfgsgtrleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrdec