PDB entry 5yuo

View 5yuo on RCSB PDB site
Description: Crystal structure of SSB protein from Pseudomonas aeruginosa PAO1
Class: DNA binding protein
Keywords: single-strand DNA binding protein, Pseudomonas aeruginosa, DNA BINDING PROTEIN
Deposited on 2017-11-22, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yuoa_
  • Chain 'B':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yuob_
  • Chain 'C':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yuoc_
  • Chain 'D':
    Compound: Single-stranded DNA-binding protein
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: ssb, PA4232
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yuod_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yuoA (A:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yuoA (A:)
    gvnkvilvgnvggdpetrympngnavtnitlatseswertewhrvvffgrlaeiageylr
    kgsqvyvegslrtrkwqdgqdrytteivvdingnmqllggr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yuoB (B:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yuoB (B:)
    rgvnkvilvgnvggdpetrympngnavtnitlatseertewhrvvffgrlaeiageylrk
    gsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yuoC (C:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yuoC (C:)
    rgvnkvilvgnvggdpetrympngnavtnitlatseswkdqertewhrvvffgrlaeiag
    eylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yuoD (D:)
    margvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvff
    grlaeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yuoD (D:)
    rgvnkvilvgnvggdpetrympngnavtnitlatsesqertewhrvvffgrlaeiageyl
    rkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllg