PDB entry 5yuf

View 5yuf on RCSB PDB site
Description: Crystal Structure of PML RING tetramer
Class: oncoprotein
Keywords: PML nuclear body biogenesis, sumoylation, RING tetramerization, PML-RARA, targeted therapy, ONCOPROTEIN
Deposited on 2017-11-22, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML, MYL, PP8675, RNF71, TRIM19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yufa_
  • Chain 'B':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML, MYL, PP8675, RNF71, TRIM19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yufb_
  • Chain 'C':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML, MYL, PP8675, RNF71, TRIM19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yufc_
  • Chain 'D':
    Compound: Protein PML
    Species: Homo sapiens [TaxId:9606]
    Gene: PML, MYL, PP8675, RNF71, TRIM19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yufd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yufA (A:)
    eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yufA (A:)
    efqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yufB (B:)
    eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yufB (B:)
    efqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yufC (C:)
    eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yufC (C:)
    fqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwpl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yufD (D:)
    eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplga
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yufD (D:)
    efqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwp