PDB entry 5yua

View 5yua on RCSB PDB site
Description: Crystal structure of voltage-gated sodium channel NavAb in high-pH condition
Class: membrane protein
Keywords: ion channel, MEMBRANE PROTEIN
Deposited on 2017-11-21, released 2017-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ion transport protein
    Species: Arcobacter butzleri [TaxId:28197]
    Gene: SAMEA4475700_01771
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yuaa1, d5yuaa2
  • Heterogens: CA, LMT, 1N7, PX4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yuaA (A:)
    gsgsmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitif
    tieiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqm
    rkivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtl
    eswsmgivrplmevypyawvffipfifvvtfvminlvvaiivdamailnqkeeqhiidev
    qshedninneiiklreeivelkeliktslkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yuaA (A:)
    gsmylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitifti
    eiilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrk
    ivsalisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtles
    wsmgivrplmevypyawvffipfifvvtfvminlvvaiivdamailnq