PDB entry 5yu9

View 5yu9 on RCSB PDB site
Description: Crystal structure of EGFR 696-1022 T790M in complex with Ibrutinib
Class: oncoprotein
Keywords: EGFR, T790M, ibrutinib, inhibitor, ONCOPROTEIN
Deposited on 2017-11-21, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5yu9a_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5yu9b_
  • Chain 'C':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5yu9c_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (98)
    Domains in SCOPe 2.07: d5yu9d_
  • Heterogens: 1E8, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yu9A (A:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu9A (A:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrekankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriythqs
    dvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmida
    dsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdade
    yl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yu9B (B:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu9B (B:)
    pnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreankeildea
    yvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvqiak
    gmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriythqsd
    vwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidad
    srpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yu9C (C:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu9C (C:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelrekankeil
    deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
    iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllkvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmvdade
    ylipqq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yu9D (D:)
    gamggeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreat
    spkankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigs
    qyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyha
    eggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
    rlpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlps
    ptdsnfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yu9D (D:)
    nqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllvpikwmalesilhriyt
    hqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwm
    idadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvd