PDB entry 5ysz

View 5ysz on RCSB PDB site
Description: transcriptional regulator CelR-cellobiose complex
Class: transcription
Keywords: transcriptional regulator, cellulase gene regulator, LacI/GalR family, cellobiose binding protein, complex, TRANSCRIPTION
Deposited on 2017-11-16, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, LacI family
    Species: Thermobifida fusca YX [TaxId:269800]
    Gene: Tfu_0938
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ysza1, d5ysza2
  • Heterogens: CBI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yszA (A:)
    mgsshhhhhhssglvprgshmerrrrptlemvaalagvgrgtvsrvingsdqvspatrea
    vkraikelgyvpnraartlvtrrtdtvalvvsennqklfaepfyagivlgvgvalsergf
    qfvlatgrsgieherlggylagqhvdgvlllslhrddplpqmldeagvpyvyggrplgvp
    eeqvsyvdidnigggrqatqrlietghrriatiagpqdmvagverlqgyreallaagmey
    detlvsygdftydsgvaamrelldrapdvdavfaasdlmglaalrvlrasgrrvpedvav
    vgyddstvaehaeppmtsvnqptelmgremarllvdritgettepvrlvlethlmvresg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yszA (A:)
    rptlemvaalagvgrgtvsrvingsdqvspatreavkraikelgyvpnrrtdtvalvvse
    nnqklfaepfyagivlgvgvalsergfqfvlatgrsgieherlggylagqhvdgvlllsl
    hrddplpqmldeagvpyvyggrplgvpeeqvsyvdidnigggrqatqrlietghrriati
    agpqdmvagverlqgyreallaagmeydetlvsygdftydsgvaamrelldrapdvdavf
    aasdlmglaalrvlrasgrrvpedvavvgyddstvaehaeppmtsvnqptelmgremarl
    lvdritgettepvrlvlethlmvresg