PDB entry 5ysw

View 5ysw on RCSB PDB site
Description: Crystal Structure Analysis of Rif16 in complex with R-L
Class: oxidoreductase
Keywords: Cytochrome P450, rifamycin, METAL BINDING PROTEIN, OXIDOREDUCTASE
Deposited on 2017-11-15, released 2018-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Amycolatopsis mediterranei (strain U-32) [TaxId:749927]
    Gene: AMED_0653
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yswa_
  • Heterogens: HEM, 9LF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yswA (A:)
    mgsshhhhhhssglvprgshmvttkvtenapsteslrsplppefvrredpfhvppalvav
    sergpvaratlaagdpfwlvsgyeearavlsdprfssdrfqyhpwfkelspefrerlrdd
    karagsfinmdppehtryrklltgqftvrrirelgarideivagrvdamlaggttadlmt
    efafpapslmicellgvryedraefqqrasallqmnapvaeavknadalrafmqalvtdk
    ranpagdiisglihhagadpaltddelinianllliagydttasmlglgifvllqrpaql
    atlrddpsriadaveellrylsvvnpgifrfakedlefagehipagstvvvsvvatnrda
    rhwpdpdldltrprgphlafghgvhqclgqqlarmemqagyaellrrlpnvrlavppeev
    plrndmltygvhslpiawdap
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yswA (A:)
    ppefvrredpfhvppalvavsergpvaratladpfwlvsgyeearavlsdprfssdrfqy
    ragsfinmdppehtryrklltgqftvrrirelgarideivagrvdamlaggttadlmtef
    afpapslmicellgvryedraefqqrasallqmnapvaeaadalrafmqalvtdkranpa
    gdiisglihhagadpaltddelinianllliagydttasmlglgifvllqrpaqlatlrd
    dpsriadaveellrylsvvnpgifrfakedlefagehipagstvvvsvvatnrdarhwpd
    pdldltrprgphlafghgvhqclgqqlarmemqagyaellrrlpnvrlavppeevplrnd
    mltygvhslpiawd