PDB entry 5ysu

View 5ysu on RCSB PDB site
Description: Plumbagin in complex with CRM1-RanM189D-RanBP1
Class: transport protein
Keywords: Active Ran, Complex, TRANSPORT PROTEIN, inhibitor
Deposited on 2017-11-15, released 2018-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (Start-215)
      • engineered mutation (188)
    Domains in SCOPe 2.08: d5ysua_
  • Chain 'B':
    Compound: Ran-specific GTPase-activating protein 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YRB1, CST20, HTN1, SFO1, YDR002W, YD8119.08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ysub_
  • Chain 'C':
    Compound: Exportin-1,Exportin-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: CRM1, KAP124, XPO1, YGR218W, G8514
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30822 (3-378)
      • expression tag (2)
    • Uniprot P30822 (379-End)
      • engineered mutation (502)
      • engineered mutation (504-506)
      • variant (987)
  • Heterogens: F2X, GTP, MG, CL, NO3, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ysuA (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvddpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysuA (A:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
    ddpalaaqyehdlevaqttalpdedddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ysuB (B:)
    dihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnk
    vrilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgsk
    enadkfkeefekaqeinkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysuB (B:)
    fepvvhktmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdk
    tlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkee
    fekaqeinkk
    

  • Chain 'C':
    No sequence available.