PDB entry 5yss

View 5yss on RCSB PDB site
Description: Crystal structure of aminocaproic acid cyclase in complex with NAD (+)
Class: oxidoreductase
Keywords: cyclase, NAD binding protein, complex, oxidoreductase
Deposited on 2017-11-15, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxybutyrate dehydrogenase
    Species: Citrobacter freundii [TaxId:546]
    Gene: AZ002_004124, BED45_07125, CES93_13130, HMPREF3212_01462, TO64_00155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yssa_
  • Chain 'B':
    Compound: 3-hydroxybutyrate dehydrogenase
    Species: Citrobacter freundii [TaxId:546]
    Gene: AZ002_004124, BED45_07125, CES93_13130, HMPREF3212_01462, TO64_00155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yssb_
  • Chain 'C':
    Compound: 3-hydroxybutyrate dehydrogenase
    Species: Citrobacter freundii [TaxId:546]
    Gene: AZ002_004124, BED45_07125, CES93_13130, HMPREF3212_01462, TO64_00155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yssc_
  • Chain 'D':
    Compound: 3-hydroxybutyrate dehydrogenase
    Species: Citrobacter freundii [TaxId:546]
    Gene: AZ002_004124, BED45_07125, CES93_13130, HMPREF3212_01462, TO64_00155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yssd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yssA (A:)
    mnltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgad
    lsdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttr
    lalpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnal
    cpgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaa
    qvrgvawnmdggwvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yssA (A:)
    nltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgadl
    sdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttrl
    alpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnalc
    pgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaaq
    vrgvawnmdggwvaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yssB (B:)
    mnltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgad
    lsdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttr
    lalpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnal
    cpgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaa
    qvrgvawnmdggwvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yssB (B:)
    nltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgadl
    sdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttrl
    alpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnalc
    pgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaaq
    vrgvawnmdggwvaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5yssC (C:)
    mnltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgad
    lsdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttr
    lalpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnal
    cpgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaa
    qvrgvawnmdggwvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yssC (C:)
    nltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgadl
    sdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttrl
    alpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnalc
    pgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaaq
    vrgvawnmdggwvaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yssD (D:)
    mnltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgad
    lsdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttr
    lalpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnal
    cpgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaa
    qvrgvawnmdggwvaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yssD (D:)
    nltgktalvtgstsgiglgiaqvlaqagatlilngfgdvdaakdavaqygktpgyhgadl
    sdeaqiadmmryaesefggvdilinnagiqhvspietfpvdkwnaiiainlssvfhttrl
    alpgmrarnwgriiniasvhglvaskeksayvaakhgvvgltktialetaqteitcnalc
    pgwvltplvqqqidkriaegaepeaardallaekqpsrefvtpeqlgnlalflcsdgaaq
    vrgvawnmdggwvaq