PDB entry 5ysd

View 5ysd on RCSB PDB site
Description: Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose
Class: sugar binding protein
Keywords: solute-binding protein, protein-carbohydrate complex, beta-1, 2-glucooligosaccharide, sophorooligosaccharide, alpha/beta domain, SUGAR BINDING PROTEIN
Deposited on 2017-11-14, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin1841 protein
    Species: Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) [TaxId:272626]
    Gene: lin1841
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92AS8 (Start-388)
      • expression tag (389-394)
    Domains in SCOPe 2.07: d5ysda1, d5ysda2
  • Chain 'B':
    Compound: Lin1841 protein
    Species: Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) [TaxId:272626]
    Gene: lin1841
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92AS8 (Start-388)
      • expression tag (389-396)
    Domains in SCOPe 2.07: d5ysdb1, d5ysdb2
  • Heterogens: MPD, MG, BGC, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ysdA (A:)
    mddanssdskvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavask
    sgpdvvqmgttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwy
    aetrvlfyrtdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgr
    qngsplfdkdgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfms
    gpwmvntlkdtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsq
    pdvqlswlkdtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygk
    sweqiyrggadvqtqmdtfndqveallkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysdA (A:)
    skvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqm
    gttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfy
    rtdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfd
    kdgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntl
    kdtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswl
    kdtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrg
    gadvqtqmdtfndqveallkklehhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ysdB (B:)
    mddanssdskvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavask
    sgpdvvqmgttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwy
    aetrvlfyrtdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgr
    qngsplfdkdgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfms
    gpwmvntlkdtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsq
    pdvqlswlkdtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygk
    sweqiyrggadvqtqmdtfndqveallkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysdB (B:)
    skvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqm
    gttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfy
    rtdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfd
    kdgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntl
    kdtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswl
    kdtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrg
    gadvqtqmdtfndqveallkklehhhhhh