PDB entry 5ysb

View 5ysb on RCSB PDB site
Description: Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form
Class: sugar binding protein
Keywords: solute-binding protein, protein-carbohydrate complex, beta-1, 2-glucooligosaccharide, sophorooligosaccharide, alpha/beta domain, SUGAR BINDING PROTEIN
Deposited on 2017-11-13, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lin1841 protein
    Species: Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) [TaxId:272626]
    Gene: lin1841
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92AS8 (Start-388)
      • expression tag (389-394)
    Domains in SCOPe 2.07: d5ysba1, d5ysba2
  • Chain 'B':
    Compound: Lin1841 protein
    Species: Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) [TaxId:272626]
    Gene: lin1841
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92AS8 (Start-388)
      • expression tag (389-394)
    Domains in SCOPe 2.07: d5ysbb1, d5ysbb2
  • Heterogens: ZN, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ysbA (A:)
    mddanssdskvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavask
    sgpdvvqmgttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwy
    aetrvlfyrtdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgr
    qngsplfdkdgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfms
    gpwmvntlkdtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsq
    pdvqlswlkdtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygk
    sweqiyrggadvqtqmdtfndqveallkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysbA (A:)
    kvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqmg
    ttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfyr
    tdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfdk
    dgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntlk
    dtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswlk
    dtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrgg
    advqtqmdtfndqveallkklehhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ysbB (B:)
    mddanssdskvlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavask
    sgpdvvqmgttwmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwy
    aetrvlfyrtdllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgr
    qngsplfdkdgtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfms
    gpwmvntlkdtapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsq
    pdvqlswlkdtnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygk
    sweqiyrggadvqtqmdtfndqveallkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ysbB (B:)
    vlnvwamgdeakslkelaqkftkdtgievkvqvipwanahdklltavasksgpdvvqmgt
    twmpefveagallditkdveksknmnsdlffpgsvkttqfdgktygvpwyaetrvlfyrt
    dllkkvgyneapktwdelsdaalklskrgkdmygfaidpneqttgfifgrqngsplfdkd
    gtpvfnkkpfvdtvtyldsfikngsapdtdlgldasqsfggdgivpmfmsgpwmvntlkd
    tapdidgkwatavlpkkennesslgganlsifkysnkkddalkfmdymsqpdvqlswlkd
    tnsmparmdaweddmlkndpyykvfgeqmktaepmplipqfeeiaqlygksweqiyrgga
    dvqtqmdtfndqveallkklehhhh