PDB entry 5ys1

View 5ys1 on RCSB PDB site
Description: Crystal structure of Multicopper Oxidase CueO G304K mutant
Class: metal binding protein
Keywords: Multicopper Oxidase, Cu-binding protein, CueO mutant, METAL BINDING PROTEIN
Deposited on 2017-11-12, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Blue copper oxidase cueO
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: CUEO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36649 (Start-515)
      • engineered mutation (303)
    Domains in SCOPe 2.07: d5ys1a1, d5ys1a2, d5ys1a3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ys1A (A:)
    mqrrdflkysvalgvasalplwsravfaaerptlpipdllttdarnriqltigagqstfg
    gktattwgyngnllgpavklqrgkavtvdiynqlteettlhwhglevpgevdggpqgiip
    pggkrsvtlnvdqpaatcwfhphqhgktgrqvamglaglvvieddeilklmlpkqwgidd
    vpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgwlrlrllngcn
    arslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndnkpfdlvtlpv
    sqmkmaiapfdkphpvmriqpiaisasgalpdtlsslpalpslegltvrklqlsmdpmld
    mmgmqmlmekygdqamagmdhsqmmghmghgnmnhmnhggkfdfhhankingqafdmnkp
    mfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegnvs
    evlvkfnhdapkehaymahchllehedtgmmlgftv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ys1A (A:)
    erptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvd
    iynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktg
    rqvamglaglvvieddeilklmlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgw
    fgdtlltngaiypqhaaprgwlrlrllngcnarslnfatsdnrplyviasdggllpepvk
    vselpvlmgerfevlvevndnkpfdlvtlpvsqmkmaiapfdkphpvmriqpiaisasga
    lpdtlsslpalpslegltvrklqlsmdpmldmmgmqmlmekygggkfdfhhankingqaf
    dmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkv
    egnvsevlvkfnhdapkehaymahchllehedtgmmlgftv