PDB entry 5yro

View 5yro on RCSB PDB site
Description: RanL182A in complex with RanBP1-CRM1
Class: transport protein
Keywords: Active Ran, Complex, TRANSPORT PROTEIN
Deposited on 2017-11-09, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (Start-215)
      • engineered mutation (181)
    Domains in SCOPe 2.07: d5yroa_
  • Chain 'B':
    Compound: Ran-specific GTPase-activating protein 1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YRB1, CST20, HTN1, SFO1, YDR002W, YD8119.08
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yrob_
  • Chain 'C':
    Compound: Exportin-1,Exportin-1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CRM1, KAP124, XPO1, YGR218W, G8514
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30822 (2-377)
      • expression tag (0-1)
    • Uniprot P30822 (378-End)
      • engineered mutation (501)
      • engineered mutation (503-505)
      • see sequence details (986)
  • Heterogens: GTP, MG, EDO, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yroA (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    aaappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yroA (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampaaappev
    vmdpalaaqyehdlevaqttalpdedddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yroB (B:)
    dihfepvvhlekvdvktmeedeevlykvraklfrfdadakewkergtgdckflknkktnk
    vrilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgsk
    enadkfkeefekaqeinkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yroB (B:)
    tmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkican
    hiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqei
    nkk
    

  • Chain 'C':
    No sequence available.